PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00303.1_g00022.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 407aa    MW: 42783.8 Da    PI: 9.314
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00303.1_g00022.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.33.5e-3890149362
                   zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              e+alkcprCdstntkfCy+nny+l+qPr+fCkaCrryWt+GGalr vPvGgg+r+nk+++
  Rsa1.0_00303.1_g00022.1  90 ETALKCPRCDSTNTKFCYFNNYNLTQPRHFCKACRRYWTRGGALRSVPVGGGCRRNKRTK 149
                              6789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3673142IPR003851Zinc finger, Dof-type
PfamPF027015.6E-3292147IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.55393147IPR003851Zinc finger, Dof-type
PROSITE patternPS01361095131IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MVFSSFPNYS DSSNWQQHQP ITTTVGFTGN NISQQFLPHH PLPPQPQQTP PPLHHNGNGG  60
GGGGPGGPGG LIRPGSMAER ARLANIPLPE TALKCPRCDS TNTKFCYFNN YNLTQPRHFC  120
KACRRYWTRG GALRSVPVGG GCRRNKRTKN SGGGGGSSSS GNSKSQDSTT SNDQYHHRAL  180
SNNQMGPPSS STSLSSLLSS YNAGLIPGHD HNSNNNNIVG LGSSLSPLKL MHPLDFTDNF  240
TLQYGAVSAP SYHTGGGSSG GSGGGGASAI LTGLDQWRFP ATHNQLPLLA GLDNSSSSGL  300
YPYDQNPGYG LVTGSGQYRP KNIFHNLVSS SSSSSSASSA MVTATASQLP SVKMEDSNNQ  360
LNMSRQLFGN EQELWNIHGT AASTAAATTS SWSDVSNNFS SSSTSNI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00483DAPTransfer from AT5G02460Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1896460.0AC189646.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS009G14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009125451.10.0PREDICTED: dof zinc finger protein DOF5.1-like
SwissprotQ9LZ561e-163DOF51_ARATH; Dof zinc finger protein DOF5.1
TrEMBLM4EJA60.0M4EJA6_BRARP; Uncharacterized protein
STRINGBra028872.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM115191732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.11e-138Dof family protein